Loading...
Statistics
Advertisement

BALKANY - balkany.info
www.balkany.info/
Balkany - balkany.info

Balkany.info

Advertisement
Conversion Technology Metas Server
Balkany.info is hosted in United States . Balkany.info uses HTTPS protocol. Number of used technologies: 1. First technologies: CSS, Number of used javascripts: 0. Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: cloudflare-nginx.

Technologies in use by Balkany.info

Technology

Number of occurences: 1
  • CSS

Advertisement

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • cloudflare-nginx

Google Analytics ID

  • UA-77805548-12

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Balkany.info

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni63339.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni63339.cloudflaressl.com
    • hash: 525bd0e9
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 248522936651903348807404848192738367952
    • validFrom: 160512000000Z
    • validTo: 161113235959Z
    • validFrom_time_t: 1463011200
    • validTo_time_t: 1479081599
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: 8E:86:2A:56:F1:35:8F:67:B5:4A:90:45:82:72:47:5E:DF:57:49:A8
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni63339.cloudflaressl.com, DNS:*.aevi.me, DNS:*.balkany.info, DNS:*.cloudworking.pl, DNS:*.cookiesandcream.me, DNS:*.denversilat.com, DNS:*.ogate.xyz, DNS:*.skrypty.info, DNS:*.sorrisando.com, DNS:*.thejourneyofdreams.com, DNS:*.thejourneyofdreams.org, DNS:aevi.me, DNS:balkany.info, DNS:cloudworking.pl, DNS:cookiesandcream.me, DNS:denversilat.com, DNS:ogate.xyz, DNS:skrypty.info, DNS:sorrisando.com, DNS:thejourneyofdreams.com, DNS:thejourneyofdreams.org

Meta - Balkany.info

Number of occurences: 5
  • Name: keywords
    Content: balkany, info, bulgaria, rumunia, serbia, chorwacja, bosnia, macedonia, czarnogora
  • Name: description
    Content: Balkany - balkany.info
  • Name: robots
    Content: index, follow
  • Name:
    Content: text/html; charset=UTF-8
  • Name: viewport
    Content: width=device-width,initial-scale=1

Server / Hosting

  • IP: 104.28.7.102
  • Latitude: 37.75
  • Longitude: -97.82
  • Country: United States

Rname

  • bayan.ns.cloudflare.com
  • isla.ns.cloudflare.com
  • mail.balkany.info

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 06 Jun 2016 07:02:26 GMT Content-Type: text/html Set-Cookie: __cfduid=db48c6034d578d1cf4d3584a0d5c798d41465196546; expires=Tue, 06-Jun-17 07:02:26 GMT; path=/; domain=.balkany.info; HttpOnly Last-Modified: Mon, 16 May 2016 11:56:45 GMT Vary: Accept-Encoding Server: cloudflare-nginx CF-RAY: 2ae9ffb041b913b3-LAX X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

DNS

host: balkany.info
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.28.6.102
host: balkany.info
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.28.7.102
host: balkany.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: bayan.ns.cloudflare.com
host: balkany.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: isla.ns.cloudflare.com
host: balkany.info
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: bayan.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2021474715
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: balkany.info
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: mail.balkany.info
host: balkany.info
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681c:766
host: balkany.info
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681c:666

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.alkany.info, www.bqalkany.info, www.qalkany.info, www.bwalkany.info, www.walkany.info, www.bzalkany.info, www.zalkany.info, www.bxalkany.info, www.xalkany.info, www.balkany.info, www.alkany.info, www.bsalkany.info, www.salkany.info, www.byalkany.info, www.yalkany.info, www.bealkany.info, www.ealkany.info, www.bdalkany.info, www.dalkany.info, www.bcalkany.info, www.calkany.info, www.blkany.info, www.baolkany.info, www.bolkany.info, www.baplkany.info, www.bplkany.info, www.ba9lkany.info, www.b9lkany.info, www.balkany.info, www.blkany.info, www.bailkany.info, www.bilkany.info, www.baulkany.info, www.bulkany.info, www.bakany.info, www.balukany.info, www.baukany.info, www.bal8kany.info, www.ba8kany.info, www.bal9kany.info, www.ba9kany.info, www.baljkany.info, www.bajkany.info, www.bal0kany.info, www.ba0kany.info, www.balmkany.info, www.bamkany.info, www.balpkany.info, www.bapkany.info, www.balokany.info, www.baokany.info, www.balany.info, www.balktany.info, www.baltany.info, www.balkany.info, www.balany.info, www.balkgany.info, www.balgany.info, www.balkbany.info, www.balbany.info, www.balknany.info, www.balnany.info, www.balkhany.info, www.balhany.info, www.balkyany.info, www.balyany.info, www.balklany.info, www.ballany.info, www.balkoany.info, www.baloany.info, www.balkuany.info, www.baluany.info, www.balkiany.info, www.baliany.info, www.balkmany.info, www.balmany.info, www.balkny.info, www.balkaony.info, www.balkony.info, www.balkapny.info, www.balkpny.info, www.balka9ny.info, www.balk9ny.info, www.balkany.info, www.balkny.info, www.balkainy.info, www.balkiny.info, www.balkauny.info, www.balkuny.info, www.balkay.info, www.balkanny.info, www.balkany.info, www.balkanhy.info, www.balkahy.info, www.balkanjy.info, www.balkajy.info, www.balkanky.info, www.balkaky.info, www.balkanly.info, www.balkaly.info, www.balkan y.info, www.balka y.info, www.balkan.info, www.balkanyz.info, www.balkanz.info, www.balkanya.info, www.balkana.info, www.balkanys.info, www.balkans.info, www.balkanyd.info, www.balkand.info, www.balkany.info, www.balkan.info, www.balkanyc.info, www.balkanc.info, www.balkany .info, www.balkan .info,

Other websites we recently analyzed

  1. nancykhawamfamilylawandmediation.org
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  2. Home - RSM Connect - Breitband für das Berchtesgadener Land und Landkreis Traunstein
    Germany - 80.255.15.136
    Server software: Apache/2.2.15 (Unix) DAV/2 mod_fcgid/2.3.6-dev SVN/1.6.11
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  3. Immobilier Dompierrois
    France - 195.154.216.236
    Server software: Apache/2.4.9 (Win64) PHP/5.5.12
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Php, Swf Object, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 1
  4. PSD to Responsive HTML5 & CSS - Slice PSD - Save 40% on every order
    Pixel perfect PSD to HTML5 and CSS converting services: PSD to Email, WordPress, Magento, global coding standards, world class quality at great prices. Full money back guarantee.
    Lansing (United States) - 50.28.14.165
    G Analytics ID: UA-55736473-1
    Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Html, Html5, Javascript, SuperFish, Zopim Live Chat, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  5. BM Scavi
    Arezzo (Italy) - 62.149.144.108
    G Analytics ID: UA-65976169-1
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SVG, Google Analytics, Wordpress
    Number of Javascript: 11
    Number of meta tags: 4
  6. Ear Mitts Ear Muffs - Bandless Ear Muffs Ear Warmers
    Earz and Ear Mitts Bandless Ear Muffs area stylish way to keep your ears protected from the wind and cold. Their unique patented design works for anyone. ONE SIZE FITS ALL! A perfect gift idea!
    Frisco (United States) - 64.251.203.56
    G Analytics ID: UA-42780856-1
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 4
  7. ### Sanitätshaus Koeppe, Wald-Apotheke, Westend-Apotheke Eberswalde ###
    Die Wald-Apotheke, Westend-Apotheke und das Sanitätshaus Koeppe versorgen Pflegeeinrichtungen, Krankenhäuser und Arztpraxen mit Medikamenten und medizinischem Bedarf. Wir liefern innerhalb Eberswalde kostenlos zu Ihnen.
    Germany - 217.160.123.26
    Server software: Apache
    Technology: CSS, Php
    Number of meta tags: 7
  8. zzhy888.com
    San Jose (United States) - 69.46.84.52
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  9. watchmenforzion.org
    Scottsdale (United States) - 184.168.221.53
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. jgwentworthsucks.com
    Scottsdale (United States) - 184.168.167.1
    Server software: Apache
    Technology: Html

Check Other Websites